PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_008025
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 137aa    MW: 15842.5 Da    PI: 7.1372
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_008025genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.41.1e-3953129177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cqve C+ad+ +ak+yhrrhkvCe+h+kap +l++gl qrfCqqCsrfhel efD++krsCrr+L +hn+rrrk +
  DCAR_008025  53 CCQVEYCTADMGNAKSYHRRHKVCEFHAKAPDALIAGLPQRFCQQCSRFHELPEFDDSKRSCRRHLLGHNQRRRKVS 129
                  6*************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-3346115IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.55651128IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.02E-3652131IPR004333Transcription factor, SBP-box
PfamPF031104.6E-3154127IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MEITKQEGGK RKKEINEEEK YEDEDEQEDD NEKKKAQSYS VSKEAGGGST QACCQVEYCT  60
ADMGNAKSYH RRHKVCEFHA KAPDALIAGL PQRFCQQCSR FHELPEFDDS KRSCRRHLLG  120
HNQRRRKVSY HFQGEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3545127284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001306237.11e-48SQUAMOSA promoter binding protein-like
RefseqXP_015063347.11e-48PREDICTED: squamosa promoter-binding protein 1 isoform X1
RefseqXP_015063348.11e-48PREDICTED: squamosa promoter-binding protein 1 isoform X1
SwissprotQ387411e-46SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLQ0PY351e-48Q0PY35_SOLLC; Squamosa promoter-binding-like protein
STRINGSolyc02g077920.2.13e-48(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.16e-39squamosa promoter binding protein-like 3